PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0205s0078.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 120aa    MW: 13826.9 Da    PI: 10.7486
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0205s0078.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.3e-333492159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                         ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r a+d+ vv++tYeg H h+
  Kalax.0205s0078.1.p 34 LDDGYRWRKYGQKAVKNNTFPRSYYRCTHPGCHVKKQVQRMAKDKGVVTTTYEGVHSHP 92
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.0E-341992IPR003657WRKY domain
SuperFamilySSF1182901.16E-292693IPR003657WRKY domain
PROSITE profilePS5081128.9312994IPR003657WRKY domain
SMARTSM007741.1E-353493IPR003657WRKY domain
PfamPF031062.5E-263592IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MRMLGVNSKS SKRCEKKARK PRYAFQTRSA VDILDDGYRW RKYGQKAVKN NTFPRSYYRC  60
THPGCHVKKQ VQRMAKDKGV VTTTYEGVHS HPIQKPADNF ESMLRQMQIY NPSLNPTSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-292493776Probable WRKY transcription factor 4
2lex_A9e-292493776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446088.11e-59PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA27e-51WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A068LC569e-60A0A068LC56_G
STRINGGSMUA_Achr9P01400_0011e-55(Musa acuminata)
STRINGGSMUA_AchrUn_randomP21800_0019e-56(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-52WRKY DNA-binding protein 75